PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17600.2.p
Common NameBRADI_5g17600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 275aa    MW: 30206.2 Da    PI: 6.704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.2e-10242646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      +eEde l++ v+ +G+ +W++I ++  + Rt+k+c++rw +
  Bradi5g17600.2.p  2 AEEDEALLEHVRTHGPCDWSSIRSKGILPRTGKSCRLRWVN 42
                      59********************8876678**********87 PP

2Myb_DNA-binding43.66.9e-145393345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Bradi5g17600.2.p 53 KFSAEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 93
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.13144IPR017930Myb domain
PfamPF139214.3E-10250No hitNo description
SuperFamilySSF466895.47E-24292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-14245IPR009057Homeodomain-like
CDDcd001671.38E-10244No hitNo description
SMARTSM007177.2E-4246IPR001005SANT/Myb domain
PROSITE profilePS5129420.19845100IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-184698IPR009057Homeodomain-like
SMARTSM007173.1E-125098IPR001005SANT/Myb domain
PfamPF002494.0E-125393IPR001005SANT/Myb domain
CDDcd001675.05E-115392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MAEEDEALLE HVRTHGPCDW SSIRSKGILP RTGKSCRLRW VNKLRPNLKS GCKFSAEEER  60
VVIELQAQFG NKWARIATYL PGRTDNDVKN FWSTRQKRLA RLLRAPLRGR SSRSSNAKAP  120
ASSLDPSVTE NLQCHQGSCH DHVSFLGTSS SGHCWASAPL MEYQVAAGIP HDQESSAFFS  180
FEGPLPLQAV PQLPLSDGEA SSSNAALFAP ELPFDQPPYH LLDFPGLSER CNIGPGFVGA  240
SAMDDLAYQE LLPIVQPAPT PMMLPFFGME CGRDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-2339833126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630002e-44AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316132e-44AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149602e-44AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126122e-44CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552182e-44CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240210.20.0PREDICTED: myb-related protein MYBAS2
TrEMBLA0A0Q3E7S20.0A0A0Q3E7S2_BRADI; Uncharacterized protein
STRINGBRADI5G17600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-56MYB family protein